Pharmacie de l'Avenir

pharmaciedelavenirmennecy.pharminfo.fr

Corbeil-Essonnes, FR

Contact information

Email detection runs continuously. Sign up to be notified when contacts are found.

Location & contact

Address47, Boulevard Charles de Gaulle, Mennecy, 91540

People at Pharmacie de l'Avenir (0 found)

We're scanning for team members at Pharmacie de l'Avenir. Profiles update weekly.

Tech stack (0 detected)

Technology detection refreshes weekly as we re-scan this domain.

Web signals

Signal detection updates every 7 days.

Professional activity

Activity tracking begins once team members are identified.

AgentData picks

DragApp

AI-powered shared inbox, help desk, and team collaboration — inside Gmail. 200K+ users.

Try DragApp free →

HeyHelp

AI email assistant inside Gmail. Drafts, sorts, follows up.

Try HeyHelp free →

Oneway

All-in-one customer platform — live chat, email, automations, changelogs & roadmaps with AI.

Try Oneway →

About

Company description updates on next crawl cycle.

CategoryPharmacy