MT Taiwanese

mttaiwanesespecialfriedchicken.co.uk

Ossett, GB

Contact information

Email detection runs continuously. Sign up to be notified when contacts are found.

Location & contact

Address27, Station Road, Ossett, WF5 8AY
HoursMo-Th 17:30-21:30, Fr-Sa 17:00-22:00

People at MT Taiwanese (0 found)

We're scanning for team members at MT Taiwanese. Profiles update weekly.

Tech stack (0 detected)

Technology detection refreshes weekly as we re-scan this domain.

Web signals

Signal detection updates every 7 days.

Professional activity

Activity tracking begins once team members are identified.

AgentData picks

DragApp

AI-powered shared inbox, help desk, and team collaboration — inside Gmail. 200K+ users.

Try DragApp free →

HeyHelp

AI email assistant inside Gmail. Drafts, sorts, follows up.

Try HeyHelp free →

Oneway

All-in-one customer platform — live chat, email, automations, changelogs & roadmaps with AI.

Try Oneway →

About

Company description updates on next crawl cycle.

CategoryFast Food Restaurant