Penang Malaysian & Thai Cuisine

penangmalaysiakennesaw.kwickmenu.com

Kennesaw, US

Contact information

Email detection runs continuously. Sign up to be notified when contacts are found.

Location & contact

Address2491, George Busbee Parkway Northwest
Hours11:00-20:30; Tu off

People at Penang Malaysian & Thai Cuisine (0 found)

We're scanning for team members at Penang Malaysian & Thai Cuisine. Profiles update weekly.

Tech stack (0 detected)

Technology detection refreshes weekly as we re-scan this domain.

Web signals

Signal detection updates every 7 days.

Professional activity

Activity tracking begins once team members are identified.

AgentData picks

DragApp

AI-powered shared inbox, help desk, and team collaboration — inside Gmail. 200K+ users.

Try DragApp free →

HeyHelp

AI email assistant inside Gmail. Drafts, sorts, follows up.

Try HeyHelp free →

Oneway

All-in-one customer platform — live chat, email, automations, changelogs & roadmaps with AI.

Try Oneway →

About

Company description updates on next crawl cycle.

CategoryRestaurant